Browse Alan Scientific’s research reference collection, including journal articles, protocols, preprints and theses on peptides and related research.
Explore publications, protocols, theses and preprints in the Alan Scientific research reference collection. The studies cover peptide-related research in chemical biology, cancer, immunology, neuroscience, cell signaling, regenerative medicine, infectious disease and plant biology.
Where the original source identifies Alan Scientific as a supplier, the relevant materials are noted with the reference. Publication links provide access to the original research and experimental details.
Troian, E. A., et al. (2026). Nucleic Acids Research, 54(7), gkag252. Research Area: Microbiology & Molecular Biology Materials supplied by Alan Scientific: Four synthetic peptides derived from newly identified ORFs, as reported in the experimental methods.Harnessing toxin-mediated ribosome stalling as a complementary tool to annotate bacterial ORFs
Reference Topic: Bacterial ORF annotation using toxin-induced ribosome stalling and synthetic peptides.
Li, X., Gan, Q., & Fan, C. (2026). Journal of the American Chemical Society, 148(11), 12411–12422. Research Area: Chemical Biology Materials supplied by Alan Scientific: Twenty aminoacyl-lysine derivatives (AA-Ks), produced by liquid-phase synthesis. These are modified amino acid building blocks; the study reports >90% purity confirmed by HPLC and MS.Expanding the Genetic Code with Lysine Aminoacylation
Reference Topic: Genetic code expansion to study site-specific lysine aminoacylation and metabolic enzyme activity.
Zhou, Q., et al. (2026). Cells, 15(9), 826. Research Area: Cancer Research Materials supplied by Alan Scientific: Dpep, Bpep, Dpepmut and Dpep123, supplied as acetate salts following TFA removal. The individual sequences are provided in Methods §2.2.Dpep, a Cell-Penetrating Peptide Targeting ATF5, CEBPB and CEBPD, Synergistically Combines with ABT-263 and Decitabine to Inhibit Cancer Cell Growth and Overcome Dpep Resistance
Reference Topic: Dpep-based combination treatments in experimental cancer models, including cells with acquired Dpep resistance.
Li, D., Voigt, A., & Nguyen, C. Q. (2026). Medicina, 62(6), 1030. Research Area: Autoimmunity & Immunology Materials supplied by Alan Scientific: Four pairs of native and PTM-mimic 15-mer peptides for splenocyte assays. Methods §2.7 reports >90% purity confirmed by HPLC.Post-Translational Modifications Modulate the HLA-DR3 Restricted Epitope Landscape of Sjögren’s Associated Autoantigens
Reference Topic: Native and post-translational-modification-mimic autoantigen peptides in HLA-DR3-restricted immune recognition.
Lopez-Garcia, O. K., et al. (2026). Journal of Proteome Research, 25(7), 3487–3506. Research Area: Microbiology & Proteomics Materials supplied by Alan Scientific: Peptides matching E-cadherin-binding motifs identified by microarray, together with scrambled controls; the reported peptide lengths are 9–20 amino acids.Coupling Far-Western Blotting with Peptide Microarrays Reveals Novel E-Cadherin Spore-Surface Ligands in Clostridioides difficile
Reference Topic: Identification of spore-surface E-cadherin-binding motifs and testing of peptide-mediated binding inhibition.
Fonseca, J. P., et al. (2025). Journal of Experimental Botany, 76(22), 7123–7134. Research Area: Plant BiologyIdentification of small signaling peptide-encoding genes modulated by host and nonhost bacterial pathogens in Arabidopsis
Reference Topic: Small signaling peptide-encoding genes involved in Arabidopsis responses to host and nonhost bacterial pathogens.
Ramprashad, J. C., Lin, Y., & Beura, L. K. (2025). STAR Protocols, 6(3), 104054. Research Area: Immunology & Cell Biology Materials supplied by Alan Scientific: Antigenic peptides gp33, SIINFEKL and SL8, as listed in the key resources table.Protocol for the coculture of murine vaginal epithelial organoids and T cells to induce resident memory CD8 T cell differentiation
Reference Topic: Antigen-specific T-cell activation and resident memory CD8 T-cell differentiation in epithelial organoid cocultures.
Nguyen, T. P., Lyu, S., & Liu, Y. (2025). FEBS Open Bio, 15(6), 914–921. Research Area: Enzymology & Cell Signaling Materials supplied by Alan Scientific: Phospho-SAMS peptide, HMRSAMpSGLHLVKRR, for assay calibration; pS denotes phosphoserine. The unphosphorylated SAMS substrate was sourced separately.An enzyme-linked immunosorbent assay (ELISA)-based activity assay for AMP-activated protein kinase (AMPK)
Reference Topic: A peptide-based ELISA method for measuring AMPK activity and assessing kinase modulators.
Hanquier, J. N., Berryhill, C. A., & Cornett, E. M. (2025). Methods in Molecular Biology, 2919, 241–250. Research Area: Epigenetics & Chemical Biology Supplier mention: Alan Scientific is listed among peptide synthesis providers in Note 2. The K-OPL libraries used for the reported data were synthesized by Pepscan.Determining the Substrate Specificity of Lysine Methyltransferases
Reference Topic: Lysine-oriented peptide libraries and individual peptide substrates for profiling lysine methyltransferase specificity.
Zhou, T., Cavalcante, R. C., Ge, C., Franceschi, R. T., & Ma, P. X. (2025). Bioactive Materials, 43, 98–113. Published online in 2024. Research Area: Regenerative Medicine & BiomaterialsSynthetic helical peptides on nanofibers to activate cell-surface receptors and synergistically enhance critical-sized bone defect regeneration
Reference Topic: Collagen-mimetic helical peptides on nanofibrous scaffolds to activate DDR2 and β1 integrins in bone regeneration models.
Neal, F. E., et al. (2025). Cell Reports, 44(5), 115654. Research Area: DNA Repair & Cancer Biology Materials supplied by Alan Scientific: FLAG peptide, DYKDDDDK, as identified in the key resources table.Distinct roles of the two BRCA2 DNA-binding domains in DNA damage repair and replication fork preservation
Reference Topic: BRCA2 domain functions in DNA repair and replication fork protection.
Azam, T. P., et al. (2025). Nature Communications, 16, 3575. Research Area: Protein Biology & Drug Discovery Materials supplied by Alan Scientific: Site 1 peptide with an N-terminal FITC label linked through aminohexanoic acid, for client-binding studies.Mechanism of client loading from BiP to GRP94 and its disruption by select inhibitors
Reference Topic: Client transfer between the endoplasmic reticulum chaperones BiP and GRP94, and inhibition of that process.
Ganta, K. K., et al. (2025). Cell Reports, 44(5), 115709. Research Area: Immunology & Infectious Disease Materials supplied by Alan Scientific: Synthetic cross-reactive peptides, as described in the methods and key resources table.Acute infectious mononucleosis generates persistent, functional EBNA-1 antibodies with high cross-reactivity to alpha-crystalline beta
Reference Topic: EBNA-1 antibody responses and cross-reactivity with self-antigens following infectious mononucleosis.
Castiglione, G. M., et al. (2025). Science, 387(6741), eadr8589. Research Area: Genetics & MetabolismRunning a genetic stop sign accelerates oxygen metabolism and energy production in horses
Reference Topic: Translational readthrough and NRF2-associated regulation of oxygen metabolism and energy production in horses.
Zhou, Q., Siegelin, M. D., & Greene, L. A. (2025). Cells, 14(9), 667. Research Area: Cancer Research & ImmunologyTargeting ATF5, CEBPB, and CEBPD with Cell-Penetrating Dpep Sensitizes Tumor Cells to NK-92MI Cell Cytotoxicity
Reference Topic: Dpep pretreatment and tumor-cell sensitivity to NK-92MI-mediated cytotoxicity in cell culture.
Raphael, I., et al. (2025). Science Translational Medicine, 17(790), eadp0675. Research Area: Cancer Immunology & Neuro-OncologyThe T cell receptor landscape of childhood brain tumors
Reference Topic: T-cell receptor repertoires, tumor antigens and antigen recognition in childhood brain tumors.
Dilollo, J., et al. (2025). Journal of Allergy and Clinical Immunology, 155(4), 1396–1399. Research Area: Allergy & Immunology Related companion preprint (2024): Companion to: A molecular basis for milk allergen immune recognition in eosinophilic esophagitis.A molecular basis for milk allergen immune recognition in eosinophilic esophagitis
Reference Topic: Milk-allergen-specific T-cell recognition in eosinophilic esophagitis.
Ulibarri, M. R., et al. (2024). Cell Reports, 43(8), 114621. Research Area: Immunology & Cell Biology Materials supplied by Alan Scientific: SIINFEKL, LCMV GP33–41 and HSV gB498–505 antigen peptides, as listed in the key resources table.Epithelial organoid supports resident memory CD8 T cell differentiation
Reference Topic: An epithelial organoid model for antigen-specific resident memory CD8 T-cell differentiation.
Trotta, R. J., Swanson, K. C., Klotz, J. L., & Harmon, D. L. (2024). PLOS ONE, 19(8), e0308983. Research Area: Animal Physiology & Nutrition Materials supplied by Alan Scientific: GLP-2 synthesized using the native bovine sequence. The study reports 96% purity measured by the manufacturer using HPLC.Influence of postruminal casein infusion and exogenous glucagon-like peptide 2 administration on the jejunal mucosal transcriptome in cattle
Reference Topic: Effects of casein and GLP-2 on gene expression in bovine jejunal mucosa.
Zhou, Q., Nguyen, T. T. T., Mun, J.-Y., Siegelin, M. D., & Greene, L. A. (2024). Cells, 13(12), 1025. Research Area: Cancer Research Materials supplied by Alan Scientific: Dpep and the mutated control peptide as acetate salts. Reported Dpep sequence: RQIKIWFQNRRMKWKKLVELSAENEKLHQRVEQLTRDLAGLRQFFK. Control sequences are listed in Methods §2.2.DPEP Inhibits Cancer Cell Glucose Uptake, Glycolysis and Survival by Upregulating Tumor Suppressor TXNIP
Reference Topic: Dpep-induced TXNIP expression and its relationship to glucose uptake, glycolysis and cancer-cell survival.
Papadopoulos, D., et al. (2024). Molecular Cell, 84(11), 2070–2086.e20. Research Area: Cancer Biology & RNA Biology Materials supplied by Alan Scientific: A 21-amino-acid peptide corresponding to MYCN residues 45–65 (Myc Box I), used in RNA-binding assays.The MYCN oncoprotein is an RNA-binding accessory factor of the nuclear exosome targeting complex
Reference Topic: MYCN interactions with RNA and the nuclear exosome targeting complex.
Deans, E. E. (2024). Doctoral dissertation, Brandeis University. Research Area: Protein Biology & Structural Biology Materials supplied by Alan Scientific: FITC-labeled Site 1 peptide with an aminohexanoic acid linker, as described in the dissertation methods.Structural Analysis and Client Binding Studies of the ER-Specific Molecular Chaperones BiP and Grp94
Reference Topic: Structural and client-binding studies of endoplasmic reticulum chaperones.
Trotta, R. J., Swanson, K. C., Klotz, J. L., & Harmon, D. L. (2023). Journal of Nutrition, 153(10), 2854–2867. Research Area: Animal Physiology & Nutrition Materials supplied by Alan Scientific: GLP-2 synthesized using the native bovine sequence, as reported in the methods.Postruminal Casein Infusion and Exogenous Glucagon-Like Peptide 2 Administration Differentially Stimulate Pancreatic α-Amylase and Small Intestinal α-Glucosidase Activity in Cattle
Reference Topic: Casein and GLP-2 effects on pancreatic and small-intestinal digestive enzyme activity in cattle.
Sun, J., et al. (2023; revised 2025). bioRxiv preprint. Research Area: Cell Signaling Materials supplied by Alan Scientific: Custom pY peptide, reported as F-Ahx-ADNDpYIIPLPD, for binding studies. Notation is reproduced as used in the preprint; pY denotes phosphotyrosine.PI(3,5)P2 Controls the Signaling Activity of Class I PI3K
Reference Topic: Phosphoinositide regulation of class I PI3K and binding of its p85 regulatory subunit.
Gothwal, A., Lamptey, R. N. L., & Singh, J. (2023). Molecular Pharmaceutics, 20(6), 3009–3019. Research Area: Neuroscience & Drug DeliveryMultifunctionalized Cationic Chitosan Polymeric Micelles Polyplexed with pVGF for Noninvasive Delivery to the Mouse Brain through the Intranasal Route for Developing Therapeutics for Alzheimer’s Disease
Reference Topic: Penetratin-functionalized chitosan micelles for intranasal delivery of a VGF-encoding plasmid in mice.
Choy, C., et al. (2023). Nature Communications, 14, 6725. Research Area: Immunology & Infectious Disease Materials supplied by Alan Scientific: Six nucleocapsid-protein peptides used for PBMC stimulation; the methods identify AlanScientific.com as their source.SARS-CoV-2 infection establishes a stable and age-independent CD8+ T cell response against a dominant nucleocapsid epitope using restricted T cell receptors
Reference Topic: CD8 T-cell recognition of SARS-CoV-2 nucleocapsid epitopes and associated T-cell receptors.
Zhou, Q., & Greene, L. A. (2023). Cancers, 15(22), 5318. Research Area: Cancer Research Materials supplied by Alan Scientific: Dpep as an acetate salt, as reported in Methods §2.2.Dpep Inhibits Cancer Cell Growth and Survival via Shared and Context-Dependent Transcriptome Perturbations
Reference Topic: Shared and cell-type-dependent transcriptional responses to Dpep across cancer cell lines.
Singaram, I., et al. (2023). Nature Chemical Biology, 19(2), 239–250. Published online in 2022. Research Area: Cancer Research & Chemical BiologyTargeting lipid–protein interaction to treat Syk-mediated acute myeloid leukemia
Reference Topic: Targeting Syk–lipid interactions in experimental models of acute myeloid leukemia.
Deans, E. E., et al. (2022). Journal of Molecular Biology, 434(13), 167638. Research Area: Protein BiologyElectrostatics drive the molecular chaperone BiP to preferentially bind oligomerized states of a client protein
Reference Topic: Electrostatic contributions to BiP binding of oligomeric client proteins.
Cohen, J. (2022). Senior thesis, Pitzer College. Pitzer Senior Theses, 131. Research Area: Tissue Engineering & BiomaterialsGrowing Meat on Plants: Using intermediate CBD-RGD fusion proteins to improve bovine satellite cell attachment on cellulose-based scaffolds
Reference Topic: CBD-RGD fusion proteins for attachment of bovine satellite cells to cellulose scaffolds.
Rajendran, M., et al. (2022). Cellular and Molecular Life Sciences, 79, 368. Research Area: NeuroscienceRestricting α-synuclein transport into mitochondria by inhibition of α-synuclein–VDAC complexation as a potential therapeutic target for Parkinson’s disease treatment
Reference Topic: Experimental inhibition of α-synuclein–VDAC interactions and mitochondrial transport.
Wolf, K. G., et al. (2022). JVS–Vascular Science, 3, 336–344. Research Area: Immunology & Vascular Biology Materials supplied by Alan Scientific: TNYL-RAW-miniPeg and a scrambled peptide control, custom ordered for coculture experiments.Ephrin-B2-expressing natural killer cells induce angiogenesis
Reference Topic: Ephrin-B2-associated interactions between natural killer cells and endothelial cells during angiogenesis.
White, S., Tran, M., & Roller, R. J. (2022). bioRxiv preprint. Research Area: VirologyHSV Tegument Protein pUL51 Interacts with Host Dynactin for Viral Spread
Reference Topic: Interactions between HSV pUL51 and host dynactin in viral spread.
Khalil, M. I., Singh, V., King, J. A., & De Benedetti, A. (2022). Molecular Oncology, 16(13), 2537–2557. Research Area: Cancer Research Materials supplied by Alan Scientific: PRAKtide, KKLRRTLSVA, used as a substrate for MK5 activity assays.TLK1-mediated MK5-S354 phosphorylation drives prostate cancer cell motility and may signify distinct pathologies
Reference Topic: TLK1–MK5 signaling, kinase activity and prostate cancer cell motility.
White, S. (2022). Doctoral dissertation, University of Iowa. Research Area: Virology Materials supplied by Alan Scientific: Chemically synthesized peptides designated 90125, tat90125 and 90125tat in the dissertation.Herpes simplex virus cytoplasmic assembly center as a tool for viral egress research and therapeutic development
Reference Topic: HSV cytoplasmic assembly, viral egress and peptide-based experimental approaches.
Noell, K., et al. (2022). JCI Insight, 7(17), e161450. Research Area: Immunology & Infectious Disease Materials supplied by Alan Scientific: Antigen peptides P1–P6, attributed to Alan Scientific in Supplemental Figure 3. Reported sequence examples: P1, FLFLGIPYAEPPVGK; P6, WRVSYEMIGSPPNVA. View the peptide table in Supplemental Figure 3.Germline IgM predicts T cell immunity to Pneumocystis
Reference Topic: Pneumocystis antigen recognition and relationships between germline IgM and T-cell immunity.
Kotler, J. L. M. (2022). Doctoral dissertation, Brandeis University. Research Area: Protein Biology Materials supplied by Alan Scientific: BiP-binding Site 1 and Site 3 peptides. The dissertation identifies a different supplier for Site 2.The molecular chaperone BiP utilizes electrostatic targeting to specifically bind oligomerized states of a client protein
Reference Topic: Electrostatic targeting and BiP interactions with oligomeric client proteins.
Zhou, Q., et al. (2021). Cancers, 13(10), 2504. Research Area: Cancer Research Supplier mention: The methods identify CSBio or AlanScientific as sources of Bpep, Dpep and mutated peptides supplied as acetate salts; individual peptide-to-supplier assignments are not specified.Cell-Penetrating CEBPB and CEBPD Leucine Zipper Decoys as Broadly Acting Anti-Cancer Agents
Reference Topic: Cell-penetrating Bpep and Dpep leucine zipper decoys in preclinical cancer models.
Zhao, R. (2021). Master of Science thesis, The University of Texas MD Anderson Cancer Center UTHealth Graduate School of Biomedical Sciences, 1154. Research Area: Cancer ResearchMitochondrial Unfolded Protein Response Regulator ATF5 in Mitochondrial Targeted Therapies in AML
Reference Topic: ATF5, the mitochondrial unfolded protein response and experimental mitochondrial-targeted approaches in AML.
Hamel, K. M. (2021). Master of Science thesis, Washington State University. Research Area: Plant BiologyThe Effect of Heat Stress and Bacteria-Delivered Plant Elicitors on Plant Immunity Against Root-Knot Nematodes
Reference Topic: Heat stress, bacteria-delivered plant elicitors and plant defenses against root-knot nematodes.
Buwaneka, P., Ralko, A., Gorai, S., Pham, H., & Cho, W. (2021). Journal of Biological Chemistry, 297(5), 101303. Research Area: Cell SignalingPhosphoinositide-binding activity of Smad2 is essential for its function in TGF-β signaling
Reference Topic: Smad2–phosphoinositide interactions and their role in TGF-β signaling.
Chiou, S. H., et al. (2021). Immunity, 54(3), 586–602.e8. Research Area: Cancer ImmunologyGlobal analysis of shared T cell specificities in human non-small cell lung cancer enables HLA inference and antigen discovery
Reference Topic: Shared T-cell specificities, HLA inference and antigen discovery in non-small cell lung cancer.
This collection includes peer-reviewed articles, published methods, preprints and academic theses. Preprints and theses are identified in their citations. Related articles, protocols and theses may describe overlapping work.
Research Area and Reference Topic are editorial classifications. Materials and specifications are reported for the cited study and do not represent specifications for every Alan Scientific order. Inclusion does not imply endorsement by the authors, journals, publishers or institutions.