$543.00 - $543.00
Human calcitonin is a 32-residue peptide hormone and endogenous ligand of the calcitonin receptor (CALCR). The mature sequence contains an intramolecular disulfide bond between Cys1 and Cys7 and terminates in Pro-NH₂, two structural features characteristic of biologically active calcitonin.
As the native human sequence, this peptide provides a useful reference ligand for studies of calcitonin receptor pharmacology, peptide structure–function relationships, osteoclast biology and species-dependent receptor responses.
Product Information
| Property | Specification |
|---|---|
| Product Name | Calcitonin, Human |
| Catalog No. | AS2639 |
| CAS No. | 21215-62-3 |
| Sequence | Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH₂ |
| One-Letter Sequence | CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH₂ |
| Peptide Length | 32 amino-acid residues |
| Molecular Formula | C151H226N40O45S3 |
| Molecular Weight | Approximately 3417.9 Da |
| Disulfide Bond | Cys1-Cys7 |
| C-Terminus | Pro-NH₂ |
| Primary Receptor | Calcitonin receptor (CALCR / CTR) |
Native Human Calcitonin Architecture
The N-terminal Cys1-Cys7 disulfide creates a short constrained ring, followed by a more flexible central and C-terminal region. The C-terminal prolinamide is also part of the mature molecular identity.
These features should be preserved when human calcitonin is used as a reference for truncated peptides, linear analogs or species variants. Removal of the disulfide architecture or alteration of the C-terminus can substantially change receptor recognition.
Reference Ligand for Calcitonin Receptor Studies
CALCR belongs to the class B GPCR family. Ligand recognition involves contributions from different regions of the peptide, allowing sequence changes among human, porcine and salmon calcitonins to produce distinct binding and signaling behavior.
Human calcitonin is therefore particularly useful as an endogenous human reference ligand in receptor activation, cAMP signaling, internalization and comparative pharmacology experiments.
Researchers investigating related family members can explore our Calcitonin & CGRP Family Peptides collection.
Experimental and Quality Considerations
Calcitonin activity can vary with receptor isoform, cell background, incubation time and ligand concentration. Human and non-human calcitonins should not be assumed to have identical receptor kinetics even when short-term potency appears similar.
For quantitative receptor or cellular studies, molecular identity, disulfide formation and chromatographic purity should be considered together. Our Peptide Quality Control capabilities support analytical HPLC and mass spectrometry according to the selected specification.
Frequently Asked Questions
Is human calcitonin a linear peptide?
The backbone is linear, but the mature peptide contains an intramolecular disulfide bond between Cys1 and Cys7 that forms an N-terminal ring.
Is the C-terminus amidated?
Yes. Mature human calcitonin terminates in Pro-NH₂.
Can calcitonin analogs or labeled variants be synthesized?
Species variants, residue substitutions, labels and other defined modifications can be evaluated through Chemical Peptide Synthesis.