$543.00 - $543.00
Porcine calcitonin is a 32-residue disulfide-bridged calcitonin peptide from pig. It retains the conserved N-terminal Cys1-Cys7 ring and C-terminal Pro-NH₂ found across mammalian calcitonins while differing substantially from the human sequence through its central and C-terminal residues.
This combination of conserved architecture and species-specific sequence variation makes porcine calcitonin useful for comparative receptor pharmacology and investigations of how peptide primary structure influences calcitonin activity.
Product Information
| Property | Specification |
|---|---|
| Product Name | Calcitonin, Porcine |
| Catalog No. | AS2640 |
| CAS No. | 12321-44-7 |
| Sequence | Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Ser-Ala-Tyr-Trp-Arg-Asn-Leu-Asn-Asn-Phe-His-Arg-Phe-Ser-Gly-Met-Gly-Phe-Gly-Pro-Glu-Thr-Pro-NH₂ |
| One-Letter Sequence | CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP-NH₂ |
| Peptide Length | 32 amino-acid residues |
| Molecular Formula | C159H232N46O45S3 |
| Molecular Weight | Approximately 3604.0 Da |
| Disulfide Bond | Cys1-Cys7 |
| C-Terminus | Pro-NH₂ |
| Research Focus | Comparative calcitonin pharmacology and species-dependent activity |
Species-Dependent Calcitonin Recognition
The first seven residues preserve the disulfide-ring architecture shared with other calcitonins, but the porcine peptide diverges considerably downstream. Notable features include Trp13 and multiple Arg, Phe and Gly residues in the central and C-terminal regions.
Comparative receptor experiments have shown that different calcitonin species can display different affinities and functional behavior at the same recombinant receptor. These differences make porcine calcitonin useful when the experimental objective is to distinguish conserved structural requirements from species-dependent determinants.
Comparing Porcine, Human and Salmon Calcitonin
Historical receptor studies found that one common human calcitonin receptor isoform displayed high affinity for both porcine and salmon calcitonin and somewhat lower affinity for human calcitonin. Biological comparisons have also demonstrated that relative activity can depend on assay format and route of administration.
We recommend comparing species peptides under the same receptor expression level, incubation period and readout rather than transferring potency values between unrelated assays.
Research Applications
Porcine calcitonin can support receptor binding studies, cAMP assays, osteoclast research, species-comparison experiments and structure–activity analysis of the calcitonin scaffold.
For studies requiring defined purity and molecular confirmation, our Peptide Quality Control capabilities can support analytical characterization according to project requirements.
Frequently Asked Questions
Is porcine calcitonin sequence-identical to human calcitonin?
No. Both peptides contain 32 residues and share the characteristic N-terminal disulfide ring, but numerous residues differ throughout the sequence.
Why use porcine calcitonin in receptor studies?
Its combination of conserved calcitonin architecture and sequence divergence makes it useful for comparing species-dependent receptor recognition and signaling.
Can other species-specific calcitonins be synthesized?
Defined calcitonin sequences and analogs can be evaluated through Chemical Peptide Synthesis.