$121.00 - $121.00
Salmon Calcitonin Acetate is an acetate-containing form of the 32-residue salmon calcitonin peptide. The active peptide retains the Cys1-Cys7 disulfide linkage and C-terminal Pro-NH₂ characteristic of salmon calcitonin.
This product is particularly relevant when salt form, peptide content and quantitative material preparation need to be considered separately from the intrinsic pharmacology of the calcitonin sequence.
Product Information
| Property | Specification |
|---|---|
| Product Name | Salmon Calcitonin Acetate |
| CAS No. | 47931-85-1 |
| Sequence | Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH₂ |
| One-Letter Sequence | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH₂ |
| Peptide Length | 32 amino-acid residues |
| Peptide Formula | C145H240N44O48S2 |
| Peptide Moiety Molecular Weight | Approximately 3431.9 Da |
| Salt Form | Acetate |
| Disulfide Bond | Cys1-Cys7 |
Peptide Identity Versus Salt Form
The 3431.9 Da value describes the salmon calcitonin peptide moiety. Bulk acetate-form material can contain additional counterion, water or other lot-dependent components that are not represented by the peptide formula alone.
For precise molar preparation, we recommend using lot-specific peptide content rather than assuming that vial mass equals 100% active peptide mass.
Why Salt Form Matters in Quantitative Work
Counterion composition can influence measured mass, solution pH and comparisons between materials obtained from different sources.
This does not change the amino-acid sequence, but it becomes relevant in receptor assays, calibration standards and analytical method development.
Our Peptide Quality Control capabilities can support identity and purity confirmation.
Frequently Asked Questions
Is salmon calcitonin acetate a different peptide sequence?
No. The peptide sequence is salmon calcitonin; acetate describes the associated salt form.
Should 3431.9 Da always be used for bulk material calculations?
It is the peptide moiety molecular weight. Lot-specific counterion and peptide-content information should be considered for precise quantitative work.