$513.00 - $513.00
GLP-1 (9-36) amide is a 28-residue metabolite generated when DPP-4 removes His7-Ala8 from bioactive GLP-1 (7-36) amide. It is a major circulating product of endogenous GLP-1 metabolism.
The truncation sharply reduces classical insulinotropic signaling through GLP-1R, but the peptide should not be described simply as biologically inactive. Experimental studies have reported additional glucoregulatory, cardiovascular and cellular effects under selected conditions.
Product Information
| Property | Specification |
|---|---|
| Product Name | GLP-1 (9-36) Amide |
| Catalog No. | AS2686 |
| Sequence | Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH₂ |
| One-Letter Sequence | EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂ |
| Peptide Length | 28 amino-acid residues |
| Molecular Formula | C140H214N36O43 |
| Molecular Weight | Approximately 3089.5 Da |
| Biological Context | DPP-4-derived GLP-1 metabolite |
DPP-4 Processing of Active GLP-1
DPP-4 cleaves GLP-1 between Ala8 and Glu9. Removal of the first two residues greatly decreases affinity and signaling potency at the canonical GLP-1 receptor.
This makes GLP-1 (9-36) amide a useful comparator for studying peptide degradation and the contribution of the N-terminal activation sequence.
Beyond a Simple Inactive Metabolite
GLP-1 (9-36) amide has shown low classical GLP-1R activity but has been associated with additional effects on glucose handling, oxidative stress and cardiovascular models in experimental studies.
We recommend distinguishing these proposed metabolite effects from the well-established GLP-1R-mediated incretin activity of GLP-1 (7-36) amide.
Research Applications
The peptide can support DPP-4 metabolism studies, GLP-1 assay validation, metabolite profiling and experiments comparing receptor-dependent and receptor-independent GLP-1 biology.