$543.00 - $543.00
GLP-1 (1-37) is a 37-residue proglucagon-derived peptide containing a six-residue N-terminal extension upstream of the mature GLP-1 activation sequence. Its sequence is HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG.
This precursor-related molecular form is useful for studying proglucagon processing and the functional importance of N-terminal maturation of GLP-1.
Product Information
| Property | Specification |
|---|---|
| Product Name | GLP-1 (1-37) |
| CAS No. | 87805-34-3 |
| Sequence | His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
| One-Letter Sequence | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Peptide Length | 37 amino-acid residues |
| Molecular Formula | C186H275N51O59 |
| Molecular Weight | Approximately 4169.5 Da |
| C-Terminus | Free carboxyl group |
| Research Context | Proglucagon processing and GLP-1 maturation |
Precursor Form Versus Mature GLP-1
The potent incretin forms GLP-1 (7-36) amide and GLP-1 (7-37) begin six residues downstream of the N-terminus of GLP-1 (1-37).
This processing difference has major functional consequences. Classical pancreatic perfusion experiments found GLP-1 (1-37) to be far less potent for insulin secretion than mature GLP-1 (7-37).
We recommend using GLP-1 (1-37) primarily when precursor processing or noncanonical biology is the experimental question, not as an interchangeable replacement for mature GLP-1.
Distinct Experimental Biology
Beyond conventional incretin assays, GLP-1 (1-37) has also been investigated in intestinal epithelial-cell models, where specific effects have been reported that differ from its weak acute insulinotropic profile.
This creates a useful example of how different proglucagon-derived molecular forms can have different biological contexts despite sharing most of their sequence.
Frequently Asked Questions
Is GLP-1 (1-37) the major active incretin form?
No. GLP-1 (7-36) amide and GLP-1 (7-37) are the better-established mature insulinotropic forms.
Does GLP-1 (1-37) contain a C-terminal amide?
No. The 37-residue form ends in Gly with a free carboxyl terminus.