$452.00 - $452.00
[Ser8]-GLP-1 (7-36) amide is a 30-residue GLP-1 analog in which Ala8 is replaced by serine. This single substitution directly modifies the DPP-4-sensitive N-terminal region of native GLP-1.
The analog was developed as a sequence-defined tool for studying how protease resistance can be improved without removing the core receptor-active properties of the GLP-1 scaffold.
Product Information
| Property | Specification |
|---|---|
| Product Name | [Ser8]-GLP-1 (7-36) Amide |
| Catalog No. | AS2568 |
| CAS No. | 215777-46-1 |
| Sequence | His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH₂ |
| One-Letter Sequence | HSEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂ |
| Peptide Length | 30 amino-acid residues |
| Molecular Formula | C149H226N40O46 |
| Molecular Weight | Approximately 3313.7 Da |
| Key Substitution | Ala8 → Ser |
Engineering the DPP-4 Cleavage Site
Native GLP-1 (7-36) amide contains His7-Ala8 at its N-terminus and is rapidly converted by DPP-4 to GLP-1 (9-36) amide.
Substitution of Ala8 with Ser changes the recognition environment for DPP-4 and significantly improves plasma stability.
Maintaining GLP-1 Biological Activity
Published work on the Ser8 analog reported improved resistance to DPP-IV-mediated degradation without loss of its insulinotropic activity under the tested conditions.
This makes the peptide particularly useful for comparing proteolytic stability versus receptor function using a single-residue modification rather than a heavily redesigned therapeutic scaffold.
Research Applications
[Ser8]-GLP-1 can support DPP-4 degradation assays, plasma-stability studies, GLP-1R signaling, beta-cell experiments and sequence–stability SAR.
For sensitive cellular work, researchers can review our Recommended Peptide Purity guidance.
Frequently Asked Questions
Which residue is modified?
Serine replaces alanine at position 8 of GLP-1.
Why does this substitution matter?
Ala8 is directly involved in the DPP-4-sensitive N-terminal sequence, so replacing it can reduce enzymatic degradation.
Can other DPP-4-resistant GLP-1 analogs be synthesized?
Defined natural and non-natural substitutions can be evaluated through Chemical Peptide Synthesis.