$543.00 - $543.00
Exendin-4 (3-39) is a 37-residue N-terminally truncated derivative of Exendin-4 used as a peptide antagonist in glucagon-like peptide-1 receptor (GLP-1R) research. Removal of the first two residues substantially reduces receptor activation while preserving much of the high-affinity receptor-binding architecture of the parent peptide.
This separation between binding and activation makes Exendin-4 (3-39) useful for receptor pharmacology, competition assays and studies of the N-terminal activation domain of class B1 GPCR peptide ligands.
Product Information
| Property | Specification |
|---|---|
| Product Name | Exendin-4 (3-39) |
| CAS No. | 196109-31-6 |
| Sequence | Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂ |
| One-Letter Sequence | EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂ |
| Peptide Length | 37 amino-acid residues |
| Molecular Formula | C176H272N46O58S |
| Molecular Weight | Approximately 3992.5 Da |
| C-Terminus | Amide |
| Research Role | GLP-1 receptor antagonist |
N-Terminal Truncation Separates Binding from Activation
Full-length Exendin-4 begins with His-Gly. Removing these first two residues markedly reduces its ability to activate GLP-1R, while the remaining peptide retains receptor-binding determinants distributed through the helical and C-terminal regions.
This property has made Exendin-4 (3-39) a useful tool for examining how class B1 GPCR peptide ligands use their N-terminal residues to trigger receptor activation after binding.
Research Applications
Exendin-4 (3-39) can support ligand-competition studies, GLP-1R antagonist experiments, receptor-mutagenesis work and comparison of agonist versus antagonist conformations.
We recommend optimizing antagonist concentration for the specific receptor-expression system rather than transferring concentrations directly between cell lines or tissue preparations.
Related GLP-1 and Exendin ligands are available in our Incretin & Metabolic Peptides collection.
Frequently Asked Questions
How does Exendin-4 (3-39) differ from full-length Exendin-4?
It lacks His1 and Gly2, leaving residues 3-39 of the original peptide.
Is Exendin-4 (3-39) commonly used as a GLP-1R antagonist?
Yes. N-terminal truncation preserves substantial receptor binding while strongly reducing activation.