$271.00 - $271.00
Exendin-4 is a 39-residue peptide agonist of the glucagon-like peptide-1 receptor (GLP-1R) originally isolated from Heloderma suspectum. Its sequence combines a receptor-activating N-terminal region with a C-terminal Exendin-specific extension that contributes to ligand affinity and conformational behavior.
Because it is structurally distinct from endogenous GLP-1 while activating the same receptor system, Exendin-4 is widely used as a reference ligand in class B1 GPCR pharmacology.
Product Information
| Property | Specification |
|---|---|
| Product Name | Exendin-4 |
| Catalog No. | AS2670 |
| CAS No. | 141758-74-9 |
| One-Letter Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂ |
| Peptide Length | 39 amino-acid residues |
| Molecular Formula | C184H282N50O60S |
| Molecular Weight | Approximately 4186.0 Da |
| C-Terminus | Amide |
| Primary Target | GLP-1 receptor |
Distinct Engagement of GLP-1R
Exendin-4 and GLP-1 both activate GLP-1R, but they do not engage the receptor identically. Structural and kinetic work has shown differences in N-terminal receptor contacts, ligand dynamics and coupling to G-protein activation.
This makes Exendin-4 valuable for studies focused on ligand-specific receptor conformations, signaling kinetics and biased or pathway-dependent responses.
DPP-4 Resistance and Experimental Stability
Native GLP-1 is rapidly cleaved by DPP-4 at its N-terminus. Exendin-4 has different N-terminal sequence chemistry and is substantially more resistant to this route of degradation.
For kinetic studies, this distinction should be considered when Exendin-4 and native GLP-1 are compared over extended incubation periods.
Research Applications
Applications include GLP-1R cAMP signaling, receptor trafficking, beta-cell research, ligand competition and development of labeled or modified receptor probes.
Custom Exendin analogs can be evaluated through our Chemical Peptide Synthesis capabilities.
Frequently Asked Questions
Is Exendin-4 the same sequence as GLP-1?
No. The two peptides share receptor pharmacology but differ substantially in primary sequence and length.
How many residues are in Exendin-4?
The peptide contains 39 amino-acid residues.