$543.00 - $543.00
Chicken calcitonin is a 32-residue avian calcitonin peptide containing the conserved Cys1-Cys7 disulfide ring and an amidated C-terminal proline.
The avian sequence provides a natural model for examining calcitonin-dependent osteoclast responses and for comparing receptor-active peptides across vertebrate species.
Product Information
| Property | Specification |
|---|---|
| Product Name | Calcitonin, Chicken |
| CAS No. | 100016-62-4 |
| Sequence | Cys-Ala-Ser-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH₂ |
| One-Letter Sequence | CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH₂ |
| Peptide Length | 32 amino-acid residues |
| Molecular Formula | C145H240N42O46S2 |
| Molecular Weight | Approximately 3371.8 Da |
| Disulfide Bond | Cys1-Cys7 |
| C-Terminus | Pro-NH₂ |
Osteoclast Motility and Bone Resorption
Chicken calcitonin has been evaluated directly in osteoclast models. Published work showed effects on neonatal rat osteoclast motility and bone-resorptive behavior, providing a useful cross-species system for examining conserved calcitonin responses.
This experimental history distinguishes chicken calcitonin from species variants used mainly as receptor-binding comparators.
Avian Sequence Architecture
The N-terminal cyclic region is conserved, while the remaining sequence contains substitutions that differentiate chicken calcitonin from mammalian and salmon peptides.
Natural sequence divergence can be useful for mapping residues associated with receptor recognition, signaling efficacy and peptide stability.
Experimental Considerations
Bone-cell assays may respond differently from recombinant receptor systems. We recommend keeping osteoclast, cAMP and receptor-binding datasets conceptually separate when comparing relative activity.
For quantitative studies, molecular identity and correct disulfide formation can be assessed using our Peptide Quality Control capabilities.
Frequently Asked Questions
How many residues are in chicken calcitonin?
The mature peptide contains 32 amino-acid residues.
Can chicken and salmon calcitonin be compared directly?
Yes, but comparisons should use matched assay conditions because receptor background and endpoint can change apparent activity.