$271.00 - $271.00
Rat calcitonin is a 32-residue peptide hormone with an N-terminal Cys1-Cys7 disulfide ring and an amidated C-terminus. It provides the native rat calcitonin sequence for experiments involving calcitonin receptor signaling, osteoclast biology and species-matched endocrine models.
The peptide is closely related to human calcitonin but contains defined sequence differences that make the rat form preferable when receptor pharmacology or biological responses are being studied in rodent systems.
Product Information
| Property | Specification |
|---|---|
| Product Name | Calcitonin, Rat |
| CAS No. | 111108-25-5 |
| Sequence | Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH₂ |
| One-Letter Sequence | CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH₂ |
| Peptide Length | 32 amino-acid residues |
| Molecular Formula | C148H228N40O46S3 |
| Molecular Weight | Approximately 3399.9 Da |
| Disulfide Bond | Cys1-Cys7 |
| C-Terminus | Pro-NH₂ |
| Primary Receptor | Calcitonin receptor (CALCR) |
Species-Matched Calcitonin Research
Rat calcitonin preserves the characteristic structural architecture of the calcitonin family while differing from human calcitonin at selected positions within the central and C-terminal regions.
These substitutions can influence receptor affinity, signaling duration and peptide stability. For experiments using rat tissues, primary cells or recombinant rat CALCR, the native rat sequence can therefore provide a more appropriate reference ligand than a heterologous calcitonin.
Disulfide Ring and C-Terminal Amidation
The Cys1-Cys7 linkage constrains the N-terminal segment of the molecule, while the terminal Pro-NH₂ forms part of the mature receptor-active peptide.
Linearized or non-amidated versions should be treated as separate molecular entities when pharmacological data are compared.
Experimental Considerations
Receptor expression, RAMP co-expression, cell background and stimulation time can all influence measured responses. We recommend reporting the exact species sequence together with receptor and assay conditions when comparing calcitonins.
Related species variants can be explored in our Calcitonin & CGRP Family Peptides collection.
Frequently Asked Questions
Is rat calcitonin identical to human calcitonin?
No. The overall architecture is conserved, but several amino-acid residues differ.
Does rat calcitonin contain a disulfide bond?
Yes. Cys1 and Cys7 form the characteristic calcitonin disulfide ring.