$754.00 - $754.00
Salmon calcitonin is a 32-residue calcitonin receptor agonist with a Cys1-Cys7 disulfide bond and C-terminal Pro-NH₂. Although it shares the characteristic architecture of mammalian calcitonins, its sequence produces a distinctive pharmacological profile at the human calcitonin receptor.
Salmon calcitonin is particularly useful for studies in which ligand residence, prolonged GPCR activation and species-dependent receptor behavior are experimental variables.
Product Information
| Property | Specification |
|---|---|
| Product Name | Calcitonin, Salmon |
| Catalog No. | AS2642 |
| CAS No. | 47931-85-1 |
| Sequence | Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH₂ |
| One-Letter Sequence | CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH₂ |
| Peptide Length | 32 amino-acid residues |
| Molecular Formula | C145H240N44O48S2 |
| Molecular Weight | Approximately 3431.9 Da |
| Disulfide Bond | Cys1-Cys7 |
| C-Terminus | Pro-NH₂ |
| Primary Receptor | Calcitonin receptor (CALCR / CTR) |
Prolonged Calcitonin Receptor Signaling
Salmon and human calcitonin can appear relatively similar in short-duration receptor assays, yet their behavior diverges substantially when signaling is followed over longer periods.
In human CALCR-expressing cell models, salmon calcitonin produced prolonged cAMP accumulation and β-arrestin recruitment that remained detectable for up to 72 hours under the reported conditions. Human calcitonin signaling declined substantially earlier.
Binding experiments from the same work also showed a slower dissociation profile for salmon calcitonin. This makes the peptide valuable for experiments focused on ligand residence time, receptor internalization and sustained GPCR signaling, not only endpoint potency.
Structural Pharmacology
Salmon calcitonin has also played an important role in structural studies of the calcitonin receptor. Receptor-bound structures have helped clarify the general class B GPCR recognition model in which the peptide C-terminal region engages the extracellular receptor domain while the N-terminal region contributes to receptor activation closer to the transmembrane core.
Sequence-dependent differences between salmon and human calcitonin therefore provide a useful system for relating peptide chemistry to receptor conformation and signaling duration.
Experimental Planning
Short-term EC50 values alone may not capture the full pharmacology of salmon calcitonin. For comparative ligand studies, we recommend recording stimulation time, receptor isoform, wash conditions and whether internalized receptor signaling contributes to the measured response.
Researchers can review our Recommended Peptide Purity guidance when selecting material for receptor or cellular experiments.
Frequently Asked Questions
Is salmon calcitonin sequence-identical to human calcitonin?
No. Both are 32-residue amidated calcitonins, but their primary sequences differ substantially.
Why is salmon calcitonin useful for receptor kinetics research?
Published experiments have demonstrated substantially longer CALCR residence and signaling behavior than human calcitonin under comparable cellular conditions.
Can truncated salmon calcitonin analogs be synthesized?
Truncations, residue substitutions and terminal modifications can be evaluated through Chemical Peptide Synthesis.