$121.00 - $121.00
Equine β-Endorphin is a 31-residue POMC-derived opioid peptide from horse. Its sequence is closely related to other mammalian β-Endorphins but contains a distinctive serine at position 6, immediately following the conserved N-terminal Met-enkephalin motif.
This natural substitution provides a useful model for investigating how a small change near the opioid pharmacophore influences peptide behavior while leaving most of the extended sequence unchanged.
Product Information
| Property | Specification |
|---|---|
| Product Name | β-Endorphin, Equine |
| Catalog No. | AS2599 |
| CAS No. | 79495-86-6 |
| Sequence | Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln |
| One-Letter Sequence | YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ |
| Peptide Length | 31 residues |
| Molecular Formula | C154H248N42O44S |
| Molecular Weight | Approximately 3423.9 Da |
| Key Species Feature | Ser6 |
Ser6 Distinguishes the Equine Sequence
Human, rat, camel and porcine β-Endorphins typically contain Thr6. The equine peptide instead contains Ser at this position.
Because both residues are polar hydroxyl-containing amino acids, the substitution is chemically conservative, yet it changes side-chain size and local hydrogen-bonding potential immediately adjacent to the Met-enkephalin domain.
A Natural Structure–Activity Probe
Equine β-Endorphin provides a way to investigate local sequence variation without introducing an artificial mutation. It can be compared with Thr6-containing mammalian peptides in receptor binding, peptide stability or analytical retention studies.
Research Applications
Potential applications include equine neuroendocrine research, opioid receptor studies, natural-sequence SAR and comparative POMC peptide analysis.
Custom β-Endorphin variants can be evaluated through Chemical Peptide Synthesis.
Frequently Asked Questions
What is the main sequence difference in equine β-Endorphin?
A notable difference is Ser6, whereas many other mammalian β-Endorphins contain Thr6.
Is the peptide C-terminally amidated?
No. The listed equine β-Endorphin terminates in Gln with a free carboxyl group.