$754.00 - $754.00
Amyloid β-Protein (1–42), Rat is the rodent counterpart of human Aβ42 and provides a sequence-defined material for investigating species-dependent amyloid behavior.
Rat and human Aβ42 retain the same strongly hydrophobic C-terminal segment but differ at several positions in the N-terminal region. These substitutions can influence local structure, molecular recognition and aggregation behavior.
Product Information
| Property | Specification |
|---|---|
| Product Name | Amyloid β-Protein (1–42), Rat |
| Sequence | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Length | 42 amino acids |
| Molecular Formula | C199H307N53O59S |
| Theoretical MW | ~4418.02 Da |
| Species | Rat |
| Peptide Type | Amyloid-β peptide |
| Research Areas | Species comparison, aggregation, antibody recognition, peptide interactions |
Why Compare Rat and Human Aβ42?
Species-specific Aβ sequences are useful when an experiment needs to distinguish effects produced by the exact human sequence from broader effects associated with Aβ42-like peptides.
Potential applications include antibody specificity studies, aggregation comparisons, peptide–protein interactions, membrane assays, and evaluation of species-dependent cellular responses.
Control the Preparation Before Comparing the Sequence
For highly aggregation-sensitive materials, sample preparation can produce differences as large as the sequence variation itself.
We recommend preparing rat and human Aβ42 under matched conditions, including the same peptide concentration, solvent treatment, buffer, incubation time and storage history.
For multi-peptide projects, consistent analytical documentation can be particularly valuable. More information is available through Peptide Quality Control.
Frequently Asked Questions
How does rat Aβ42 differ from human Aβ42?
Rat and human Aβ42 differ at several N-terminal residues while sharing the hydrophobic C-terminal region. Key differences occur at residues 5, 10, and 13, providing a useful model for studying species-dependent recognition and aggregation.
Why use rat Aβ42 in an amyloid experiment?
Rat Aβ42 can help determine whether an antibody, receptor, protein interaction, aggregation phenotype, or cellular response depends specifically on the human Aβ sequence.
Does rat Aβ42 aggregate like human Aβ42?
Rat Aβ42 can aggregate, but its sequence differences can alter assembly behavior relative to the human peptide. The outcome also depends strongly on concentration, buffer, temperature, and preparation history.
What is the best control for rat Aβ42?
For species-comparison studies, human Aβ42 prepared under the same conditions is usually the most informative comparator. Using different preparation protocols for the two peptides can obscure the actual effect of the sequence differences.
Research Use Only.