$754.00 - $754.00
Amyloid β-Protein (1–49), or Aβ49, is a long, highly hydrophobic Aβ species associated with the early stages of intramembrane APP processing by γ-secretase.
Its experimental role differs from that of Aβ40 and Aβ42. Rather than serving primarily as a mature extracellular amyloid species, Aβ49 is particularly useful for studying γ-secretase processivity and sequential C-terminal cleavage.
Product Information
| Property | Specification |
|---|---|
| Product Name | Amyloid β-Protein (1–49) |
| Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL |
| Length | 49 amino acids |
| Molecular Formula | C239H376N62O69S |
| Theoretical MW | ~5254.06 Da |
| Peptide Type | Long APP-derived Aβ species |
| Research Areas | γ-Secretase, presenilin, APP processing, processive trimming |
| Key Pathway | Aβ49 → Aβ46 → Aβ43 → Aβ40 |
Aβ49 as a Processing Intermediate
Aβ49 lies within an established γ-secretase trimming pathway:
Aβ49 → Aβ46 → Aβ43 → Aβ40
Synthetic Aβ49 can therefore support biochemical studies examining enzyme processivity, C-terminal cleavage and the effects of presenilin or γ-secretase perturbations.
Hydrophobicity Is a Practical Consideration
The extended C-terminal sequence makes Aβ49 substantially more hydrophobic than Aβ40 or Aβ42.
This has consequences for synthesis, purification and experimental handling. A nominally high-purity sample may still produce poor experimental reproducibility if reconstitution results in incomplete recovery or heterogeneous aggregation.
We recommend defining the downstream buffer and assay conditions before choosing the final specification for this peptide.
Difficult hydrophobic sequences and custom Aβ variants can be evaluated through Custom Peptide Synthesis.
Frequently Asked Questions
What is Aβ49?
Aβ49 is a 49-residue APP-derived amyloid-β species associated with an early stage of γ-secretase processing. It contains a longer and more hydrophobic C-terminal region than Aβ40 or Aβ42.
What role does Aβ49 play in γ-secretase processing?
Aβ49 participates in the processive trimming pathway:
Aβ49 → Aβ46 → Aβ43 → Aβ40
For this reason, synthetic Aβ49 is especially useful as a mechanistic substrate in studies of γ-secretase and presenilin function.
Why is Aβ49 more difficult to handle than Aβ40 or Aβ42?
The additional hydrophobic C-terminal residues substantially increase the peptide's hydrophobicity. This can affect purification, reconstitution, recovery, adsorption to surfaces, and formation of heterogeneous aggregates.
Is very high HPLC purity sufficient for Aβ49 experiments?
Not by itself. Identity and purity remain important, but effective solubilization and a reproducible preparation protocol can be equally important. A highly pure Aβ49 sample that is incompletely dispersed may still produce inconsistent experimental concentrations.
Research Use Only.