$754.00 - $754.00
[Gly22]-Amyloid β-Protein (1–40) is the E22G Arctic variant of Aβ40, in which glutamate at position 22 is replaced by glycine.
E22G is a disease-associated Aβ substitution linked to the Arctic APP mutation and is widely used to study how changes in the central region of Aβ alter peptide self-assembly.
Product Information
| Property | Specification |
|---|---|
| Product Name | [Gly22]-Amyloid β-Protein (1–40) |
| Mutation | E22G / Arctic |
| Sequence | DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV |
| Length | 40 amino acids |
| Molecular Formula | C191H291N53O56S |
| Theoretical MW | ~4257.80 Da |
| Parent Peptide | Human Aβ40 |
| Peptide Type | Disease-associated Aβ40 variant |
| Research Areas | Protofibrils, aggregation kinetics, familial AD, amyloid assembly |
Why the E22G Substitution Matters
Glu22 contributes a negatively charged side chain within a region important for Aβ intermolecular interactions.
Replacing this residue with glycine removes the charge and changes local conformational flexibility.
E22G Aβ40 can therefore support studies of protofibril formation, oligomerization, fibril morphology and mutation-dependent responses to aggregation modulators.
Selecting the Correct Control
For mutation-focused experiments, wild-type human Aβ40 is the most direct comparator.
E22G Aβ42 may provide additional information, but it contains two additional C-terminal residues and therefore introduces peptide length as another variable.
Researchers requiring additional familial Aβ variants can use Custom Peptide Synthesis.
Frequently Asked Questions
What is [Gly22]-Aβ40?
[Gly22]-Aβ40 is the E22G Arctic variant of Aβ40, in which glutamate at residue 22 is replaced by glycine.
Why is E22G called the Arctic mutation?
E22G corresponds to the Aβ sequence change produced by the familial Alzheimer-associated Arctic APP mutation. It has been extensively studied for its effects on oligomerization, protofibril formation, and amyloid assembly.
What does the E22G substitution change chemically?
The substitution removes a negatively charged glutamate side chain and replaces it with glycine, which is small, uncharged, and conformationally flexible. This changes both local electrostatics and structural behavior within an important central region of Aβ.
Is Arctic Aβ40 the same as Arctic Aβ42?
No. Both contain E22G, but Aβ42 contains the additional Ile41 and Ala42 residues. Because C-terminal length strongly affects amyloid behavior, E22G Aβ40 and E22G Aβ42 should be treated as different experimental materials.
Research Use Only.