$754.00 - $754.00
Amyloid β-Protein (1–40), Rat is the 40-residue rodent amyloid-β sequence generated from APP processing.
It provides a useful counterpart to human Aβ40 for experiments investigating species-specific sequence effects on aggregation, antibody recognition, transport and peptide–protein interactions.
Product Information
| Property | Specification |
|---|---|
| Product Name | Amyloid β-Protein (1–40), Rat |
| Sequence | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Length | 40 amino acids |
| Molecular Formula | C190H291N51O57S |
| Theoretical MW | ~4233.78 Da |
| Species | Rat |
| Peptide Type | Amyloid-β peptide |
| Research Areas | Species comparison, aggregation, antibody studies, peptide interactions |
Species-Dependent Aβ Biology
Rat Aβ40 retains the hydrophobic C-terminal portion of the human peptide but contains several substitutions toward the N-terminus.
These differences can affect recognition by sequence-sensitive antibodies and other binding partners and may influence aggregation or biological response.
Rat Aβ40 is therefore useful when studying whether a result is dependent specifically on the human sequence.
Procurement for Comparative Experiments
When rat and human Aβ peptides are purchased for the same experiment, We recommend keeping purity specification, terminal state, analytical documentation and sample preparation as consistent as possible.
This makes subsequent interpretation and replication considerably easier.
Custom rodent or human amyloid sequences can be evaluated through Custom Peptide Synthesis.
Frequently Asked Questions
What is rat Aβ40 used for?
Rat Aβ40 is commonly used in comparative amyloid research to investigate species-dependent aggregation, antibody recognition, peptide transport, clearance, and molecular interactions.
How is rat Aβ40 different from human Aβ40?
The two peptides share the hydrophobic C-terminal region but differ at several residues near the N-terminus. These substitutions can influence sequence-specific recognition and may alter peptide assembly or biological interactions.
Should rat Aβ40 be used as a negative control for human Aβ40?
Not generally. Rat Aβ40 is better considered a species variant rather than an inactive control. It remains an authentic amyloid-β peptide capable of undergoing molecular interactions and self-assembly.
How should human and rat Aβ40 be compared experimentally?
The two peptides should ideally be matched for purity, concentration, terminal chemistry, reconstitution method, incubation conditions, and storage history so that species sequence remains the main experimental variable.
Research Use Only.