$181.00 - $181.00
Porcine β-Endorphin is a 31-residue endogenous opioid peptide derived from the porcine POMC/β-lipotropin pathway. It retains the conserved Tyr-Gly-Gly-Phe-Met opioid motif while containing a species-specific C-terminal sequence distinct from human, rat and several other mammalian β-Endorphins.
The peptide is particularly useful for swine pituitary-processing studies and comparative analysis of naturally occurring β-Endorphin sequences.
Product Information
| Property | Specification |
|---|---|
| Product Name | β-Endorphin, Porcine |
| Catalog No. | AS2601 |
| Sequence | Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Val-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln |
| One-Letter Sequence | YGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ |
| Peptide Length | 31 amino-acid residues |
| Molecular Formula | C154H248N42O44S |
| Molecular Weight | Approximately 3424.0 Da |
| C-Terminus | Gln-OH |
| Research Context | POMC processing, opioid biology and swine endocrine research |
A Single Natural Substitution Distinguishes the Porcine Sequence
Porcine β-Endorphin differs from the camel/bovine-like sequence at position 23, where Val replaces Ile. The remaining C-terminal His27 and Gln31 residues are characteristic of several non-human mammalian forms.
This creates a useful natural structure–activity comparison in which most of the 31-residue scaffold is conserved while a single hydrophobic side chain changes.
Sequential Processing in Porcine Pituitary
Classical porcine pituitary studies showed that full-length β-Endorphin(1-31) can be generated from β-lipotropin before subsequent C-terminal processing produces shorter β-Endorphin-related products.
This makes the intact porcine peptide particularly relevant to precursor-processing experiments rather than only receptor activation assays.
Research Applications
Porcine β-Endorphin can support opioid receptor pharmacology, pituitary peptide processing, endocrine-cell research, species comparisons and analytical studies of β-Endorphin-related fragments.
For custom truncations or species variants, researchers can use our Chemical Peptide Synthesis capabilities.
Frequently Asked Questions
Is porcine β-Endorphin the same sequence as human β-Endorphin?
No. Several residues toward the C-terminus differ, including Val23, His27 and Gln31 in the porcine sequence.
Why use the porcine peptide?
It is useful for species-matched swine studies and for investigating POMC-derived peptide processing in porcine pituitary or endocrine systems.